PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013635316.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 396aa    MW: 44595.5 Da    PI: 5.298
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013635316.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.27e-172269148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT  Ed+ll+ +v ++G g+W+++ ++ g+ R++k+c++rw ++l
   XP_013635316.1 22 KGPWTSAEDQLLIGYVDKHGEGNWNAVQKHSGLSRCGKSCRLRWVNHL 69
                     79*******************************************996 PP

2Myb_DNA-binding44.14.7e-1475118146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++T  E+++ v++++ +G++ W++ a+ ++ gRt++++k++w++
   XP_013635316.1  75 KGSFTDKEEQRVVELHASMGNK-WARMAAQLP-GRTDNEIKNFWNT 118
                      799*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.6041769IPR017930Myb domain
SuperFamilySSF466894.21E-2820116IPR009057Homeodomain-like
SMARTSM007171.1E-132171IPR001005SANT/Myb domain
PfamPF002491.8E-152269IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.7E-232376IPR009057Homeodomain-like
CDDcd001677.94E-112469No hitNo description
PROSITE profilePS5129423.54270124IPR017930Myb domain
SMARTSM007171.6E-1374122IPR001005SANT/Myb domain
PfamPF002491.0E-1275118IPR001005SANT/Myb domain
CDDcd001673.71E-977120No hitNo description
Gene3DG3DSA:1.10.10.605.5E-2477122IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 396 aa     Download sequence    Send to blast
MGKGGHDSGS GKYFAIEKTF HKGPWTSAED QLLIGYVDKH GEGNWNAVQK HSGLSRCGKS  60
CRLRWVNHLR PSLKKGSFTD KEEQRVVELH ASMGNKWARM AAQLPGRTDN EIKNFWNTRL  120
KKLQRLGLPI YPDEVREQAM NAAAQNGQNS DHSQESLEPD CLEIPEFDFK YLQLNNYQSV  180
LLRNVPMGNM MKHCSFQPNM YNLIGSPYMS PNRKRVREQE TDFLDTGDYA TNEQSAQLWN  240
QKQFHVVPES HLLGNATTYS SPPSEPEAEK LELPSFQCFD PPGDWETQHS NPMPAVESDR  300
TLVQSPLTDC PSSGLLESVV YGSSGEKQAT NSTDPDSPLL LQSSLFGHIE LTPAFENNTE  360
TDMFPFGPTS SSERGTSLES GDWIRQLLGE DRDYTK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-28221227106B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKR0765470.0KR076547.1 Brassica napus MYB transcription factor 81-1 (MYB81-1.1) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013635316.10.0PREDICTED: transcription factor MYB104-like isoform X1
TrEMBLA0A0D3BUK30.0A0A0D3BUK3_BRAOL; Uncharacterized protein
STRINGBra012038.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM91982138
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G26960.11e-134myb domain protein 81